IRF2 (Human) Recombinant Protein
  • IRF2 (Human) Recombinant Protein

IRF2 (Human) Recombinant Protein

Ref: AB-P8172
IRF2 (Human) Recombinant Protein

Información del producto

Human IRF2 (P14316, 1 a.a. - 113 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IRF2
Gene Alias DKFZp686F0244|IRF-2
Gene Description interferon regulatory factor 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLP
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris pH 8 (1mM DTT, 10% glycerol)
Gene ID 3660

Enviar un mensaje


IRF2 (Human) Recombinant Protein

IRF2 (Human) Recombinant Protein