View larger
Human IRF2 (P14316, 1 a.a. - 113 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</
AB-P8172
New product
IRF2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | IRF2 |
| Gene Alias | DKFZp686F0244|IRF-2 |
| Gene Description | interferon regulatory factor 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLP |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris pH 8 (1mM DTT, 10% glycerol) |
| Gene ID | 3660 |
More info
Human IRF2 (P14316, 1 a.a. - 113 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.