IFNA14 (Human) Recombinant Protein Ver mas grande

IFNA14 (Human) Recombinant Protein

AB-P8149

Producto nuevo

IFNA14 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name IFNA14
Gene Alias LEIF2H|MGC125756|MGC125757
Gene Description interferon, alpha 14
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.2M NaCl, 2mM DTT, 50% glycerol)
Gene ID 3448

Más información

Human IFNA14 (P01570, 24 a.a. - 189 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Consulta sobre un producto

IFNA14 (Human) Recombinant Protein

IFNA14 (Human) Recombinant Protein