IFNA14 (Human) Recombinant Protein
  • IFNA14 (Human) Recombinant Protein

IFNA14 (Human) Recombinant Protein

Ref: AB-P8149
IFNA14 (Human) Recombinant Protein

Información del producto

Human IFNA14 (P01570, 24 a.a. - 189 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IFNA14
Gene Alias LEIF2H|MGC125756|MGC125757
Gene Description interferon, alpha 14
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.2M NaCl, 2mM DTT, 50% glycerol)
Gene ID 3448

Enviar un mensaje


IFNA14 (Human) Recombinant Protein

IFNA14 (Human) Recombinant Protein