IFNA14 (Human) Recombinant Protein View larger

Human IFNA14 (P01570, 24 a.a. - 189 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia col

AB-P8149

New product

IFNA14 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name IFNA14
Gene Alias LEIF2H|MGC125756|MGC125757
Gene Description interferon, alpha 14
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.2M NaCl, 2mM DTT, 50% glycerol)
Gene ID 3448

More info

Human IFNA14 (P01570, 24 a.a. - 189 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human IFNA14 (P01570, 24 a.a. - 189 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia col

Human IFNA14 (P01570, 24 a.a. - 189 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia col