AB-P9744
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Size | 100 ug |
Gene Name | LGR5 |
Gene Alias | FEX|GPR49|GPR67|GRP49|HG38|MGC117008 |
Gene Description | leucine-rich repeat-containing G protein-coupled receptor 5 |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKA |
Form | Lyophilized |
Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | SEC-HPLC and Tris-Bis PAGE |
Storage Buffer | Lyophilized from sterile distilled Water is > |
Gene ID | 8549 |