LGR5 (Human) Recombinant Protein Ver mas grande

LGR5 (Human) Recombinant Protein

AB-P9744

Producto nuevo

LGR5 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 100 ug
Gene Name LGR5
Gene Alias FEX|GPR49|GPR67|GRP49|HG38|MGC117008
Gene Description leucine-rich repeat-containing G protein-coupled receptor 5
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKA
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 8549

Más información

Human LGR5 (O75473-1, 22 a.a. - 543 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.

Consulta sobre un producto

LGR5 (Human) Recombinant Protein

LGR5 (Human) Recombinant Protein