View larger
Human LGR5 (O75473-1, 22 a.a. - 543 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
AB-P9744
New product
LGR5 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | LGR5 |
| Gene Alias | FEX|GPR49|GPR67|GRP49|HG38|MGC117008 |
| Gene Description | leucine-rich repeat-containing G protein-coupled receptor 5 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKA |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SEC-HPLC and Tris-Bis PAGE |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 8549 |
More info
Human LGR5 (O75473-1, 22 a.a. - 543 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.