Ver mas grande
NRP1 (Human) Recombinant Protein
AB-P9739
Producto nuevo
NRP1 (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NRP1 |
| Gene Alias | BDCA4|CD304|DKFZp686A03134|DKFZp781F1414|NP1|NRP|VEGF165R |
| Gene Description | neuropilin 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCM |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SEC-HPLC and Tris-Bis PAGE |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 8829 |
Más información
Human NRP1 (NP_001019799.1, 22 a.a. - 644 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.