NRP1 (Human) Recombinant Protein View larger

Human NRP1 (NP_001019799.1, 22 a.a. - 644 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells

AB-P9739

New product

NRP1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100 ug
Gene Name NRP1
Gene Alias BDCA4|CD304|DKFZp686A03134|DKFZp781F1414|NP1|NRP|VEGF165R
Gene Description neuropilin 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCM
Form Lyophilized
Recomended Dilution Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 8829

More info

Human NRP1 (NP_001019799.1, 22 a.a. - 644 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Enviar uma mensagem

Human NRP1 (NP_001019799.1, 22 a.a. - 644 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells

Human NRP1 (NP_001019799.1, 22 a.a. - 644 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells