AB-P9710
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Size | 100 ug |
Gene Name | RAET1L |
Gene Alias | - |
Gene Description | retinoic acid early transcript 1L |
Storage Conditions | Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSG |
Form | Liquid |
Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | SEC-HPLC and Tris-Bis PAGE |
Storage Buffer | In PBS pH 7.4 |
Gene ID | 154064 |