RAET1L (Human) Recombinant Protein View larger

Human RAET1L (Q5VY80, 26 a.a. - 218 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.

AB-P9710

New product

RAET1L (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100 ug
Gene Name RAET1L
Gene Alias -
Gene Description retinoic acid early transcript 1L
Storage Conditions Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSG
Form Liquid
Recomended Dilution Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer In PBS pH 7.4
Gene ID 154064

More info

Human RAET1L (Q5VY80, 26 a.a. - 218 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.

Enviar uma mensagem

Human RAET1L (Q5VY80, 26 a.a. - 218 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.

Human RAET1L (Q5VY80, 26 a.a. - 218 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.