AB-P9704
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Size | 100 ug |
Gene Name | FLT3 |
Gene Alias | CD135|FLK2|STK1 |
Gene Description | fms-related tyrosine kinase 3 |
Storage Conditions | Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | NQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGF |
Form | Liquid |
Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | SEC-HPLC and Tris-Bis PAGE |
Storage Buffer | In PBS pH 7.4 |
Gene ID | 2322 |