Ver mas grande
FLT3 (Human) Recombinant Protein
AB-P9704
Producto nuevo
FLT3 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | FLT3 |
| Gene Alias | CD135|FLK2|STK1 |
| Gene Description | fms-related tyrosine kinase 3 |
| Storage Conditions | Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | NQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGF |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SEC-HPLC and Tris-Bis PAGE |
| Storage Buffer | In PBS pH 7.4 |
| Gene ID | 2322 |
Más información
Human FLT3 (P36888-1, 27 a.a. - 541 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.