FLT3 (Human) Recombinant Protein
  • FLT3 (Human) Recombinant Protein

FLT3 (Human) Recombinant Protein

Ref: AB-P9704
FLT3 (Human) Recombinant Protein

Información del producto

Human FLT3 (P36888-1, 27 a.a. - 541 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name FLT3
Gene Alias CD135|FLK2|STK1
Gene Description fms-related tyrosine kinase 3
Storage Conditions Store at -80C for 12 Month.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE
Immunogen Prot. Seq NQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGF
Form Liquid
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer In PBS pH 7.4
Gene ID 2322

Enviar uma mensagem


FLT3 (Human) Recombinant Protein

FLT3 (Human) Recombinant Protein