DLL3 (Human) Recombinant Protein Ver mas grande

DLL3 (Human) Recombinant Protein

AB-P9698

Producto nuevo

DLL3 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 100 ug
Gene Name DLL3
Gene Alias SCDO1
Gene Description delta-like 3 (Drosophila)
Storage Conditions Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq VSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAA
Form Liquid
Recomended Dilution Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer In PBS pH 7.4
Gene ID 10683

Más información

Human DLL3 (Q9NYJ7-1, 311 a.a. - 479 a.a.) partial recombinant protein with His tag and Avi tag at C-terminus expressed in HEK293 cells.

Consulta sobre un producto

DLL3 (Human) Recombinant Protein

DLL3 (Human) Recombinant Protein