DLL3 (Human) Recombinant Protein
  • DLL3 (Human) Recombinant Protein

DLL3 (Human) Recombinant Protein

Ref: AB-P9698
DLL3 (Human) Recombinant Protein

Información del producto

Human DLL3 (Q9NYJ7-1, 311 a.a. - 479 a.a.) partial recombinant protein with His tag and Avi tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name DLL3
Gene Alias SCDO1
Gene Description delta-like 3 (Drosophila)
Storage Conditions Store at -80C for 12 Month.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE
Immunogen Prot. Seq VSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAA
Form Liquid
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer In PBS pH 7.4
Gene ID 10683

Enviar uma mensagem


DLL3 (Human) Recombinant Protein

DLL3 (Human) Recombinant Protein