AB-P9698
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Size | 100 ug |
Gene Name | DLL3 |
Gene Alias | SCDO1 |
Gene Description | delta-like 3 (Drosophila) |
Storage Conditions | Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | VSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAA |
Form | Liquid |
Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | SEC-HPLC and Tris-Bis PAGE |
Storage Buffer | In PBS pH 7.4 |
Gene ID | 10683 |