CD36 (Human) Recombinant Protein
  • CD36 (Human) Recombinant Protein

CD36 (Human) Recombinant Protein

Ref: AB-P9694
CD36 (Human) Recombinant Protein

Información del producto

Human CD36 (P16671, 30 a.a. - 439 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name CD36
Gene Alias CHDS7|FAT|GP3B|GP4|GPIV|PASIV|SCARB3
Gene Description CD36 molecule (thrombospondin receptor)
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADLGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFES
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 948

Enviar un mensaje


CD36 (Human) Recombinant Protein

CD36 (Human) Recombinant Protein