CD36 (Human) Recombinant Protein View larger

Human CD36 (P16671, 30 a.a. - 439 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.

AB-P9694

New product

CD36 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 5 ug
Gene Name CD36
Gene Alias CHDS7|FAT|GP3B|GP4|GPIV|PASIV|SCARB3
Gene Description CD36 molecule (thrombospondin receptor)
Storage Conditions Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ADLGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFES
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 948

More info

Human CD36 (P16671, 30 a.a. - 439 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.

Enviar uma mensagem

Human CD36 (P16671, 30 a.a. - 439 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.

Human CD36 (P16671, 30 a.a. - 439 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.