CD14 (Human) Recombinant Protein
  • CD14 (Human) Recombinant Protein

CD14 (Human) Recombinant Protein

Ref: AB-P9627
CD14 (Human) Recombinant Protein

Información del producto

Human CD14 (P08571, 20 a.a. - 352 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name CD14
Gene Alias -
Gene Description CD14 molecule
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMW
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from 1X PBS is >
Gene ID 929

Enviar un mensaje


CD14 (Human) Recombinant Protein

CD14 (Human) Recombinant Protein