CD14 (Human) Recombinant Protein View larger

Human CD14 (P08571, 20 a.a. - 352 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

AB-P9627

New product

CD14 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name CD14
Gene Alias -
Gene Description CD14 molecule
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMW
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from 1X PBS is &gt
Gene ID 929

More info

Human CD14 (P08571, 20 a.a. - 352 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Enviar uma mensagem

Human CD14 (P08571, 20 a.a. - 352 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Human CD14 (P08571, 20 a.a. - 352 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.