Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CDKN1B (Human) Recombinant Protein
Abnova
CDKN1B (Human) Recombinant Protein
Ref: AB-P9611
CDKN1B (Human) Recombinant Protein
Contáctenos
Información del producto
Human CDKN1B (P46527, 1 a.a. - 198 a.a.) full recombinant protein with His tag at N-terminus expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
CDKN1B
Gene Alias
CDKN4|KIP1|MEN1B|MEN4|P27KIP1
Gene Description
cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Form
Liquid
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
In 20mM Tris-HCl pH 8.0 (20% glycerol)
Gene ID
1027
Enviar un mensaje
CDKN1B (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*