CDKN1B (Human) Recombinant Protein
  • CDKN1B (Human) Recombinant Protein

CDKN1B (Human) Recombinant Protein

Ref: AB-P9611
CDKN1B (Human) Recombinant Protein

Información del producto

Human CDKN1B (P46527, 1 a.a. - 198 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CDKN1B
Gene Alias CDKN4|KIP1|MEN1B|MEN4|P27KIP1
Gene Description cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (20% glycerol)
Gene ID 1027

Enviar uma mensagem


CDKN1B (Human) Recombinant Protein

CDKN1B (Human) Recombinant Protein