CXCL12 (Human) Recombinant Protein
  • CXCL12 (Human) Recombinant Protein

CXCL12 (Human) Recombinant Protein

Ref: AB-P9570
CXCL12 (Human) Recombinant Protein

Información del producto

Human CXCL12 (P48061, 23 a.a. - 89 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CXCL12
Gene Alias PBSF|SCYB12|SDF-1a|SDF-1b|SDF1|SDF1A|SDF1B|TLSF-a|TLSF-b|TPAR1
Gene Description chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is 0.5 mg/mL
Gene ID 6387

Enviar un mensaje


CXCL12 (Human) Recombinant Protein

CXCL12 (Human) Recombinant Protein