CXCL12 (Human) Recombinant Protein View larger

Human CXCL12 (P48061, 23 a.a. - 89 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli

AB-P9570

New product

CXCL12 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name CXCL12
Gene Alias PBSF|SCYB12|SDF-1a|SDF-1b|SDF1|SDF1A|SDF1B|TLSF-a|TLSF-b|TPAR1
Gene Description chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MKHHHHHHASKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is 0.5 mg/mL
Gene ID 6387

More info

Human CXCL12 (P48061, 23 a.a. - 89 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human CXCL12 (P48061, 23 a.a. - 89 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli

Human CXCL12 (P48061, 23 a.a. - 89 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli