CXCL9 (Human) Recombinant Protein Ver mas grande

CXCL9 (Human) Recombinant Protein

AB-P9531

Producto nuevo

CXCL9 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name CXCL9
Gene Alias CMK|Humig|MIG|SCYB9|crg-10
Gene Description chemokine (C-X-C motif) ligand 9
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.15 M NaCl and 30% glycerol)
Gene ID 4283

Más información

Human CXCL9 (Q07325, 23 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Consulta sobre un producto

CXCL9 (Human) Recombinant Protein

CXCL9 (Human) Recombinant Protein