View larger
Human CXCL9 (Q07325, 23 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli
AB-P9531
New product
CXCL9 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CXCL9 |
| Gene Alias | CMK|Humig|MIG|SCYB9|crg-10 |
| Gene Description | chemokine (C-X-C motif) ligand 9 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (0.15 M NaCl and 30% glycerol) |
| Gene ID | 4283 |
More info
Human CXCL9 (Q07325, 23 a.a. - 125 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.