Ver mas grande
Cxcl2 (Mouse) Recombinant Protein
AB-P9466
Producto nuevo
Cxcl2 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Cxcl2 |
| Gene Alias | CINC-2a|GROb|Gro2|MIP-2|MIP-2a|Mgsa-b|Mip2|Scyb|Scyb2 |
| Gene Description | chemokine (C-X-C motif) ligand 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 20310 |
Más información
Mouse Cxcl2 (P10889, 35 a.a. - 107 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.