Cxcl2 (Mouse) Recombinant Protein
  • Cxcl2 (Mouse) Recombinant Protein

Cxcl2 (Mouse) Recombinant Protein

Ref: AB-P9466
Cxcl2 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl2 (P10889, 35 a.a. - 107 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Cxcl2
Gene Alias CINC-2a|GROb|Gro2|MIP-2|MIP-2a|Mgsa-b|Mip2|Scyb|Scyb2
Gene Description chemokine (C-X-C motif) ligand 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 20310

Enviar uma mensagem


Cxcl2 (Mouse) Recombinant Protein

Cxcl2 (Mouse) Recombinant Protein