GDNF (Human) Recombinant Protein Ver mas grande

GDNF (Human) Recombinant Protein

AB-P9414

Producto nuevo

GDNF (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 ug
Gene Name GDNF
Gene Alias ATF1|ATF2|HFB1-GDNF
Gene Description glial cell derived neurotrophic factor
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Quality control testing SDS-PAGE
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 2668

Más información

Human GDNF (P39905, 78 a.a. - 211 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

GDNF (Human) Recombinant Protein

GDNF (Human) Recombinant Protein