Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
GDNF (Human) Recombinant Protein
Abnova
GDNF (Human) Recombinant Protein
Ref: AB-P9414
GDNF (Human) Recombinant Protein
Contacte-nos
Información del producto
Human GDNF (P39905, 78 a.a. - 211 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
GDNF
Gene Alias
ATF1|ATF2|HFB1-GDNF
Gene Description
glial cell derived neurotrophic factor
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Form
Lyophilized
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Quality control testing
SDS-PAGE
Storage Buffer
Lyophilized from sterile distilled Water is >
Gene ID
2668
Enviar uma mensagem
GDNF (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*