Ver mas grande
MS4A1 (Human) Recombinant Protein
AB-P9404
Producto nuevo
MS4A1 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | MS4A1 |
| Gene Alias | B1|Bp35|CD20|LEU-16|MGC3969|MS4A2|S7 |
| Gene Description | membrane-spanning 4-domains, subfamily A, member 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ADPGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSPHHHHHH |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 931 |
Más información
Human MS4A1 (P11836, 210 a.a. - 297 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.