MS4A1 (Human) Recombinant Protein
  • MS4A1 (Human) Recombinant Protein

MS4A1 (Human) Recombinant Protein

Ref: AB-P9404
MS4A1 (Human) Recombinant Protein

Información del producto

Human MS4A1 (P11836, 210 a.a. - 297 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name MS4A1
Gene Alias B1|Bp35|CD20|LEU-16|MGC3969|MS4A2|S7
Gene Description membrane-spanning 4-domains, subfamily A, member 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSPHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 931

Enviar uma mensagem


MS4A1 (Human) Recombinant Protein

MS4A1 (Human) Recombinant Protein