Ver mas grande
CDC42 (Human) Recombinant Protein
AB-P9359
Producto nuevo
CDC42 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | CDC42 |
| Gene Alias | CDC42Hs|G25K |
| Gene Description | cell division cycle 42 (GTP binding protein, 25kDa) |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MASMTGGQQMGRGSHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 2 mM EDTA, 1 mM DTT. |
| Gene ID | 998 |
Más información
Human CDC42 full-length recombinant protein with T7 tag in N-terminus expressed in Escherichia coli.