CDC42 (Human) Recombinant Protein
  • CDC42 (Human) Recombinant Protein

CDC42 (Human) Recombinant Protein

Ref: AB-P9359
CDC42 (Human) Recombinant Protein

Información del producto

Human CDC42 full-length recombinant protein with T7 tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name CDC42
Gene Alias CDC42Hs|G25K
Gene Description cell division cycle 42 (GTP binding protein, 25kDa)
Storage Conditions Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MASMTGGQQMGRGSHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Form Liquid
Antigen species Target species Human
Storage Buffer Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 2 mM EDTA, 1 mM DTT.
Gene ID 998

Enviar uma mensagem


CDC42 (Human) Recombinant Protein

CDC42 (Human) Recombinant Protein