Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CDC42 (Human) Recombinant Protein
Abnova
CDC42 (Human) Recombinant Protein
Ref: AB-P9359
CDC42 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CDC42 full-length recombinant protein with T7 tag in N-terminus expressed in
Escherichia coli
.
Información adicional
Size
50 ug
Gene Name
CDC42
Gene Alias
CDC42Hs|G25K
Gene Description
cell division cycle 42 (GTP binding protein, 25kDa)
Storage Conditions
Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq
MASMTGGQQMGRGSHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Form
Liquid
Antigen species Target species
Human
Storage Buffer
Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 2 mM EDTA, 1 mM DTT.
Gene ID
998
Enviar uma mensagem
CDC42 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*