THY1 (Human) Recombinant Protein
  • THY1 (Human) Recombinant Protein

THY1 (Human) Recombinant Protein

Ref: AB-P9339
THY1 (Human) Recombinant Protein

Información del producto

Human THY1 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 5 ug
Gene Name THY1
Gene Alias CD90|FLJ33325
Gene Description Thy-1 cell surface antigen
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 7070

Enviar un mensaje


THY1 (Human) Recombinant Protein

THY1 (Human) Recombinant Protein