AB-P9339
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 5 ug |
Gene Name | THY1 |
Gene Alias | CD90|FLJ33325 |
Gene Description | Thy-1 cell surface antigen |
Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCHHHHHH |
Form | Liquid |
Antigen species Target species | Human |
Storage Buffer | Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
Gene ID | 7070 |