THY1 (Human) Recombinant Protein View larger

Human THY1 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.

AB-P9339

New product

THY1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 5 ug
Gene Name THY1
Gene Alias CD90|FLJ33325
Gene Description Thy-1 cell surface antigen
Storage Conditions Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 7070

More info

Human THY1 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.

Enviar uma mensagem

Human THY1 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.

Human THY1 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.