Ver mas grande
VEGFA (Human) Recombinant Protein
AB-P9333
Producto nuevo
VEGFA (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVY |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 1X PBS, and reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5 mg/mL. Let the lyophilized pellet dissolve completely. |
Más información
Human VEGFA partial recombinant protein with His tag expressed in HEK293 cells.