VEGFA (Human) Recombinant Protein View larger

Human VEGFA partial recombinant protein with His tag expressed in HEK293 cells.

AB-P9333

New product

VEGFA (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Storage Conditions Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVY
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 1X PBS, and reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5 mg/mL. Let the lyophilized pellet dissolve completely.

More info

Human VEGFA partial recombinant protein with His tag expressed in HEK293 cells.

Enviar uma mensagem

Human VEGFA partial recombinant protein with His tag expressed in HEK293 cells.

Human VEGFA partial recombinant protein with His tag expressed in HEK293 cells.