NAMPT (Human) Recombinant Protein Ver mas grande

NAMPT (Human) Recombinant Protein

AB-P9331

Producto nuevo

NAMPT (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 25 ug
Gene Name NAMPT
Gene Alias 1110035O14Rik|DKFZp666B131|MGC117256|PBEF|PBEF1|VF|VISFATIN
Gene Description nicotinamide phosphoribosyltransferase
Storage Conditions Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKD
Form Liquid
Antigen species Target species Human
Storage Buffer Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 mM DTT.
Gene ID 10135

Más información

Human NAMPT recombinant protein with His tag in N-terminus expressed in Escherichia coli.

Consulta sobre un producto

NAMPT (Human) Recombinant Protein

NAMPT (Human) Recombinant Protein