Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
NAMPT (Human) Recombinant Protein
Abnova
NAMPT (Human) Recombinant Protein
Ref: AB-P9331
NAMPT (Human) Recombinant Protein
Contacte-nos
Información del producto
Human NAMPT recombinant protein with His tag in N-terminus expressed in
Escherichia coli
.
Información adicional
Size
25 ug
Gene Name
NAMPT
Gene Alias
1110035O14Rik|DKFZp666B131|MGC117256|PBEF|PBEF1|VF|VISFATIN
Gene Description
nicotinamide phosphoribosyltransferase
Storage Conditions
Store at 4C for one weeks and should be stored at -20C to -80C for long term storage.
Avoid repeated freeze/thaw cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKD
Form
Liquid
Antigen species Target species
Human
Storage Buffer
Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 mM DTT.
Gene ID
10135
Enviar uma mensagem
NAMPT (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*