Ver mas grande
VEGFE (Orf Virus) Recombinant Protein
AB-P9327
Producto nuevo
VEGFE (Orf Virus) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHDSTKTWSEVFENSGCKPRPMVFRVHDEHPELTSQRFNPPCVTLMRCGGCCNDESLECVPTEEANVTMQLMGASVSGGNGMQHLSFVEHKKCDCKPPLTTTPPTTTRPPRRRR |
| Form | Lyophilized |
| Antigen species Target species | Viruses |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 50 ug/mL. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin. |
Más información
Orf Virus VEGFE recombinant protein with His tag in N-terminus expressed in?Escherichia coli.