View larger
Orf Virus VEGFE recombinant protein with His tag in N-terminus expressed in?<i>Escherichia coli</i>.
AB-P9327
New product
VEGFE (Orf Virus) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHDSTKTWSEVFENSGCKPRPMVFRVHDEHPELTSQRFNPPCVTLMRCGGCCNDESLECVPTEEANVTMQLMGASVSGGNGMQHLSFVEHKKCDCKPPLTTTPPTTTRPPRRRR |
| Form | Lyophilized |
| Antigen species Target species | Viruses |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 50 ug/mL. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin. |
More info
Orf Virus VEGFE recombinant protein with His tag in N-terminus expressed in?Escherichia coli.