Thpo (Mouse) Recombinant Protein
  • Thpo (Mouse) Recombinant Protein

Thpo (Mouse) Recombinant Protein

Ref: AB-P9291
Thpo (Mouse) Recombinant Protein

Información del producto

Mouse Thpo partial recombinant protein with His tag in C-terminus expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name Thpo
Gene Alias Mpllg|TPO|TPO-1|TPO-2|TPO-3|TPO-4
Gene Description thrombopoietin
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDIS
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 21832

Enviar un mensaje


Thpo (Mouse) Recombinant Protein

Thpo (Mouse) Recombinant Protein