View larger
Mouse Thpo partial recombinant protein with His tag in C-terminus expressed in HEK293 cells.
AB-P9291
New product
Thpo (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Thpo |
| Gene Alias | Mpllg|TPO|TPO-1|TPO-2|TPO-3|TPO-4 |
| Gene Description | thrombopoietin |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDIS |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 21832 |
More info
Mouse Thpo partial recombinant protein with His tag in C-terminus expressed in HEK293 cells.