THPO (Human) Recombinant Protein
  • THPO (Human) Recombinant Protein

THPO (Human) Recombinant Protein

Ref: AB-P9287
THPO (Human) Recombinant Protein

Información del producto

Human THPO recombinant protein expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name THPO
Gene Alias MGC163194|MGDF|MKCSF|ML|MPLLG|TPO
Gene Description thrombopoietin
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (0.74 mg/mL) was lyophilized from 1X PBS. Reconstitute the lyophilized powder in PBS containing 0.1% endotoxin-free recombinant HSA.
Gene ID 7066

Enviar un mensaje


THPO (Human) Recombinant Protein

THPO (Human) Recombinant Protein