Ver mas grande
THPO (Human) Recombinant Protein
AB-P9287
Producto nuevo
THPO (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | THPO |
| Gene Alias | MGC163194|MGDF|MKCSF|ML|MPLLG|TPO |
| Gene Description | thrombopoietin |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (0.74 mg/mL) was lyophilized from 1X PBS. Reconstitute the lyophilized powder in PBS containing 0.1% endotoxin-free recombinant HSA. |
| Gene ID | 7066 |
Más información
Human THPO recombinant protein expressed in HEK293 cells.