THPO (Human) Recombinant Protein View larger

Human THPO recombinant protein expressed in HEK293 cells.

AB-P9287

New product

THPO (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name THPO
Gene Alias MGC163194|MGDF|MKCSF|ML|MPLLG|TPO
Gene Description thrombopoietin
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (0.74 mg/mL) was lyophilized from 1X PBS. Reconstitute the lyophilized powder in PBS containing 0.1% endotoxin-free recombinant HSA.
Gene ID 7066

More info

Human THPO recombinant protein expressed in HEK293 cells.

Enviar uma mensagem

Human THPO recombinant protein expressed in HEK293 cells.

Human THPO recombinant protein expressed in HEK293 cells.