Ver mas grande
Tslp (Mouse) Recombinant Protein
AB-P9283
Producto nuevo
Tslp (Mouse) Recombinant Protein
Comprando este producto generará 17 Biopuntos. Su cesta contiene un total 17 Biopuntos puede ser convertido en un Biobonos Descuento 68.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | Tslp |
| Gene Alias | - |
| Gene Description | thymic stromal lymphopoietin |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | ADPYNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 53603 |
Más información
Mouse Tslp partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.