Tslp (Mouse) Recombinant Protein
  • Tslp (Mouse) Recombinant Protein

Tslp (Mouse) Recombinant Protein

Ref: AB-P9283
Tslp (Mouse) Recombinant Protein

Información del producto

Mouse Tslp partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 50 ug
Gene Name Tslp
Gene Alias -
Gene Description thymic stromal lymphopoietin
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPYNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPEHHHHHH
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 53603

Enviar un mensaje


Tslp (Mouse) Recombinant Protein

Tslp (Mouse) Recombinant Protein