View larger
Mouse Tslp partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
AB-P9283
New product
Tslp (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 17 pontos de fidelização. Seu carrinho totalizará 17 pontos de fidelização que podem ser convertidos num vale de desconto de 68.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | Tslp |
| Gene Alias | - |
| Gene Description | thymic stromal lymphopoietin |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | ADPYNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 53603 |
More info
Mouse Tslp partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.