Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
Tnfrsf14 (Mouse) Recombinant Protein
Abnova
Tnfrsf14 (Mouse) Recombinant Protein
Ref: AB-P9274
Tnfrsf14 (Mouse) Recombinant Protein
Contáctenos
Información del producto
Mouse Tnfrsf14 partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size
2 x 10 ug
Gene Name
Tnfrsf14
Gene Alias
Atar|HveA|Hvem|MGC123498|MGC123499|Tnfrs14
Gene Description
tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Storage Conditions
Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
Form
Liquid
Antigen species Target species
Mouse
Storage Buffer
Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID
230979
Enviar un mensaje
Tnfrsf14 (Mouse) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*