View larger
Mouse Tnfrsf14 partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.
AB-P9274
New product
Tnfrsf14 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Tnfrsf14 |
| Gene Alias | Atar|HveA|Hvem|MGC123498|MGC123499|Tnfrs14 |
| Gene Description | tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 230979 |
More info
Mouse Tnfrsf14 partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.