Ver mas grande
Tnfsf4 (Mouse) Recombinant Protein
AB-P9252
Producto nuevo
Tnfsf4 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Tnfsf4 |
| Gene Alias | Ath-1|Ath1|CD134L|OX-40L|Ox40l|TXGP1|Txgp1l|gp34 |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 4 |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | ADPSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPLHHHHHH |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 22164 |
Más información
Mouse Tnfsf4 partial recombinant protein expressedn with His tag in C-terminus in Baculovirus cells.