Tnfsf4 (Mouse) Recombinant Protein
  • Tnfsf4 (Mouse) Recombinant Protein

Tnfsf4 (Mouse) Recombinant Protein

Ref: AB-P9252
Tnfsf4 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfsf4 partial recombinant protein expressedn with His tag in C-terminus in Baculovirus cells.
Información adicional
Size 2 x 10 ug
Gene Name Tnfsf4
Gene Alias Ath-1|Ath1|CD134L|OX-40L|Ox40l|TXGP1|Txgp1l|gp34
Gene Description tumor necrosis factor (ligand) superfamily, member 4
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq ADPSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPLHHHHHH
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 22164

Enviar uma mensagem


Tnfsf4 (Mouse) Recombinant Protein

Tnfsf4 (Mouse) Recombinant Protein