AB-P9252
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 2 x 10 ug |
Gene Name | Tnfsf4 |
Gene Alias | Ath-1|Ath1|CD134L|OX-40L|Ox40l|TXGP1|Txgp1l|gp34 |
Gene Description | tumor necrosis factor (ligand) superfamily, member 4 |
Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | ADPSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPLHHHHHH |
Form | Liquid |
Antigen species Target species | Mouse |
Storage Buffer | Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
Gene ID | 22164 |